DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and AT3G42830

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_189869.1 Gene:AT3G42830 / 823327 AraportID:AT3G42830 Length:115 Species:Arabidopsis thaliana


Alignment Length:133 Identity:90/133 - (67%)
Similarity:95/133 - (71%) Gaps:29/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWDIVVD 68
            :.....||||||| :.||||:||                            |:||||||||||||
plant    12 ESSSISVPSSSSK-NSKRFELKK----------------------------WSAVALWAWDIVVD 47

  Fly    69 NCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQK 133
            ||||||||||||||||.||||||||||||||||||||||||||||||||||||||||..||:|||
plant    48 NCAICRNHIMDLCIECLANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDVCEWEFQK 112

  Fly   134 YGH 136
            |||
plant   113 YGH 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 75/82 (91%)
zf-rbx1 53..126 CDD:289448 68/72 (94%)
AT3G42830NP_189869.1 mRING-H2-C3H2C2D_RBX1 47..108 CDD:319399 57/60 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4222
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I1290
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 1 1.000 - - FOG0003438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.