DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and Anapc11

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001033319.1 Gene:Anapc11 / 66156 MGIID:1913406 Length:84 Species:Mus musculus


Alignment Length:84 Identity:33/84 - (39%)
Similarity:46/84 - (54%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KQWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLK 117
            |.||.||.|.|....:||.|||......|.:|:     ...::|.:.||.|:|.||.|||.:||.
Mouse     6 KCWNGVATWLWVANDENCGICRMAFNGCCPDCK-----VPGDDCPLVWGQCSHCFHMHCILKWLN 65

  Fly   118 TRQV---CPLDNREWDFQK 133
            .:||   ||:..:||.|::
Mouse    66 AQQVQQHCPMCRQEWKFKE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 33/84 (39%)
zf-rbx1 53..126 CDD:289448 30/75 (40%)
Anapc11NP_001033319.1 RING_Ubox 1..84 CDD:418438 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.