DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and Roc1b

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_652613.1 Gene:Roc1b / 53445 FlyBaseID:FBgn0040291 Length:122 Species:Drosophila melanogaster


Alignment Length:100 Identity:65/100 - (65%)
Similarity:78/100 - (78%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CTDG----NTSSFPLRRKQWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAW 100
            |:.|    .|..|.:  |:|.|.|:|.||:.||||||||||||:|||||||: .:|..:||||||
  Fly    25 CSGGAVQARTERFVV--KKWVAHAMWGWDVAVDNCAICRNHIMNLCIECQAD-PNANQDECTVAW 86

  Fly   101 GVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG 135
            |.||||||:|||:||||||.||||||:||.:||||
  Fly    87 GECNHAFHYHCIARWLKTRLVCPLDNKEWVYQKYG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 60/82 (73%)
zf-rbx1 53..126 CDD:289448 53/72 (74%)
Roc1bNP_652613.1 RING 35..122 CDD:302633 61/89 (69%)
zf-rbx1 36..112 CDD:289448 54/78 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463166
Domainoid 1 1.000 106 1.000 Domainoid score I1444
eggNOG 1 0.900 - - E1_COG5194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 1 1.000 - - FOG0003438
OrthoInspector 1 1.000 - - otm46583
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2333
1110.810

Return to query results.
Submit another query.