powered by:
Protein Alignment Roc1a and lmgB
DIOPT Version :9
Sequence 1: | NP_001138143.2 |
Gene: | Roc1a / 31014 |
FlyBaseID: | FBgn0025638 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097124.1 |
Gene: | lmgB / 44128 |
FlyBaseID: | FBgn0085470 |
Length: | 365 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 13/52 - (25%) |
Similarity: | 19/52 - (36%) |
Gaps: | 14/52 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 SSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVA-LWA 62
||||.| ..|..|.|:........:.||:...:.:: |||
Fly 117 SSSSTG-------------ATSSTIDNQLAILRREMYGLRQLDLSLLSQLWA 155
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Roc1a | NP_001138143.2 |
APC11 |
53..136 |
CDD:227521 |
3/11 (27%) |
zf-rbx1 |
53..126 |
CDD:289448 |
3/11 (27%) |
lmgB | NP_001097124.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5194 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.