DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and Rnf7

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001100318.1 Gene:Rnf7 / 300948 RGDID:1311048 Length:113 Species:Rattus norvegicus


Alignment Length:131 Identity:53/131 - (40%)
Similarity:67/131 - (51%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWDIVVDN 69
            |||.|....||.           ||...|:       .|....|.|  |:|||||:|:||:..|.
  Rat     5 EDGEEPCVLSSH-----------SGSAGSK-------SGGDKMFSL--KKWNAVAMWSWDVECDT 49

  Fly    70 CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKY 134
            |||||..:||.|:.|||..   ..|:|.|.||.|||:||..|:|.|:|....|||..::|..|:.
  Rat    50 CAICRVQVMDACLRCQAEN---KQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRI 111

  Fly   135 G 135
            |
  Rat   112 G 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 41/83 (49%)
zf-rbx1 53..126 CDD:289448 38/72 (53%)
Rnf7NP_001100318.1 RING-H2_RBX2 47..106 CDD:319380 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.