DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and Rbx1

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001029307.1 Gene:Rbx1 / 300084 RGDID:1308453 Length:108 Species:Rattus norvegicus


Alignment Length:137 Identity:95/137 - (69%)
Similarity:99/137 - (72%) Gaps:34/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEVDEDGYEVPSSSSKG-DKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWD 64
            |:||     .||.::.| .||||||||                            ||||||||||
  Rat     5 MDVD-----TPSGTNSGAGKKRFEVKK----------------------------WNAVALWAWD 36

  Fly    65 IVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREW 129
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    37 IVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREW 101

  Fly   130 DFQKYGH 136
            :||||||
  Rat   102 EFQKYGH 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 79/82 (96%)
zf-rbx1 53..126 CDD:289448 70/72 (97%)
Rbx1NP_001029307.1 mRING-H2-C3H2C2D_RBX1 40..101 CDD:319399 60/60 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353986
Domainoid 1 1.000 138 1.000 Domainoid score I4741
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I3605
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 1 1.000 - - FOG0003438
OrthoInspector 1 1.000 - - oto95936
orthoMCL 1 0.900 - - OOG6_102466
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.