DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and Rnf7

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_035409.1 Gene:Rnf7 / 19823 MGIID:1337096 Length:113 Species:Mus musculus


Alignment Length:131 Identity:53/131 - (40%)
Similarity:67/131 - (51%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWDIVVDN 69
            |||.|....||.           ||...|:       .|....|.|  |:|||||:|:||:..|.
Mouse     5 EDGEEPCVLSSH-----------SGSAGSK-------SGGDKMFSL--KKWNAVAMWSWDVECDT 49

  Fly    70 CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKY 134
            |||||..:||.|:.|||..   ..|:|.|.||.|||:||..|:|.|:|....|||..::|..|:.
Mouse    50 CAICRVQVMDACLRCQAEN---KQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRI 111

  Fly   135 G 135
            |
Mouse   112 G 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 41/83 (49%)
zf-rbx1 53..126 CDD:289448 38/72 (53%)
Rnf7NP_035409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 9/38 (24%)
RING-H2_RBX2 47..106 CDD:319380 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.