DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1a and rbx-2

DIOPT Version :9

Sequence 1:NP_001138143.2 Gene:Roc1a / 31014 FlyBaseID:FBgn0025638 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_491849.1 Gene:rbx-2 / 172344 WormBaseID:WBGene00019993 Length:112 Species:Caenorhabditis elegans


Alignment Length:118 Identity:46/118 - (38%)
Similarity:66/118 - (55%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWDIVVDNCAICRNH 76
            ::||..|          .|:.|.....:.|...:.|.|...|:|||:|:||||:..|.|||||.|
 Worm     2 NNSSNAD----------SQEGSTSAQKQKTANPSESRPFVLKKWNALAVWAWDVECDTCAICRVH 56

  Fly    77 IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREW 129
            :|:.|:.||    |..|.||.|.||.|||:||..|:::|::....|||..::|
 Worm    57 LMEECLRCQ----SEPSAECYVVWGDCNHSFHHCCMTQWIRQNNRCPLCQKDW 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1aNP_001138143.2 APC11 53..136 CDD:227521 38/77 (49%)
zf-rbx1 53..126 CDD:289448 37/72 (51%)
rbx-2NP_491849.1 RING-H2_RBX2 47..105 CDD:319380 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S381
OMA 1 1.010 - - QHG54028
OrthoDB 1 1.010 - - D1587140at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1071
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.