DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Roc1a and rbx1

DIOPT Version :9

Sequence 1:	NP_001138143.2	Gene:	Roc1a / 31014	FlyBaseID:	FBgn0025638	Length:	136	Species:	Drosophila melanogaster
Sequence 2:	XP_002934772.2	Gene:	rbx1 / 100379935	XenbaseID:	XB-GENE-5779767	Length:	120	Species:	Xenopus tropicalis

Alignment Length:	137	Identity:	94/137 - (68%)
Similarity:	99/137 - (72%)	Gaps:	34/137 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEVDEDGYEVPS-SSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWD 64
            |:||     .|| :::...||||||||                            ||||||||||
Frog    17 MDVD-----TPSGTNNSASKKRFEVKK----------------------------WNAVALWAWD 48

  Fly    65 IVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREW 129
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Frog    49 IVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREW 113

  Fly   130 DFQKYGH 136
            :||||||
Frog   114 EFQKYGH 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Roc1a	NP_001138143.2	APC11	53..136	CDD:227521	79/82 (96%)
Roc1a	NP_001138143.2	zf-rbx1	53..126	CDD:289448	70/72 (97%)
rbx1	XP_002934772.2	mRING-H2-C3H2C2D_RBX1	52..113	CDD:319399	60/60 (100%)
rbx1	XP_002934772.2	modified RING-H2 finger (C3H2C2D-type)	54..109	CDD:319399	54/54 (100%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	138	1.000	Domainoid score	I4813
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	1	1.000	-	-		H6872
Inparanoid	1	1.050	190	1.000	Inparanoid score	I3763
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1587140at2759
OrthoFinder	1	1.000	-	-		FOG0003438
OrthoInspector	1	1.000	-	-		oto102676
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X2333
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	7	7.060