DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13367 and GATAD1

DIOPT Version :9

Sequence 1:NP_569851.2 Gene:CG13367 / 31013 FlyBaseID:FBgn0025634 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_066990.3 Gene:GATAD1 / 57798 HGNCID:29941 Length:269 Species:Homo sapiens


Alignment Length:277 Identity:108/277 - (38%)
Similarity:139/277 - (50%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LNGTANQAPTRSPTIIKRLRKSTRFKAKQTGKGTPGSGSSQSNGHNSGANGSTGSS-------VH 219
            |..|.:...|.|.::.|:..:........||:|..|||     |..|||.|.||.|       ..
Human     5 LKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSG-----GAGSGAAGGTGGSGGGGFGAAT 64

  Fly   220 LAGAGAHPSNTNKHG---------------------KSGPAGTGG-ATGARNRRALFK-KPAQKT 261
            .|...|.|..:|..|                     ||.||.... :|..:.||.:|| |...|.
Human    65 FASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKA 129

  Fly   262 PKVQASTRFVRSLFHKGSYIQIGDIVSIVDSEQNL-YYAQIRGLLVDAYCEKSAFLTWLIPTQDS 325
            |:..::.....|:|:||.|.||||:||::|.:... |||||||.:.|.||||||.|||||||..|
Human   130 PESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSS 194

  Fly   326 PDPQEGFDPPTYLIGPDEELSRKLCYLEFVMHAPSNYYFDRSTPFP-LPDVDEYTAQRSGGYIWT 389
            |..|  |||.:|:|||:|:|.||:.|||||.||||.|:..||:||| :|...|      .|||||
Human   195 PRDQ--FDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPE------KGYIWT 251

  Fly   390 RL----PIVKREKGSGH 402
            .:    .|..:|..:.|
Human   252 HVGPTPAITIKESVANH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13367NP_569851.2 None
GATAD1NP_066990.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..115 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147722
Domainoid 1 1.000 150 1.000 Domainoid score I4380
eggNOG 1 0.900 - - E1_2CNB2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4374
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007227
OrthoInspector 1 1.000 - - oto91461
orthoMCL 1 0.900 - - OOG6_108552
Panther 1 1.100 - - LDO PTHR13340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6068
SonicParanoid 1 1.000 - - X5332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.