DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13367 and gatad1

DIOPT Version :9

Sequence 1:NP_569851.2 Gene:CG13367 / 31013 FlyBaseID:FBgn0025634 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001163977.1 Gene:gatad1 / 100125784 XenbaseID:XB-GENE-965954 Length:268 Species:Xenopus tropicalis


Alignment Length:258 Identity:105/258 - (40%)
Similarity:135/258 - (52%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LNGTANQAPTRSPTIIKRLRKSTRFKAKQTGKGTPGSGSSQSNGHNSGANGSTGSSVHLAG---A 223
            |..|.:...|.:.::.|:..:........:||.: .|.|...|.:|||..|||..|....|   |
 Frog     5 LKPTCSMCKTNTSSMWKKGNQGEILCNNCSGKSS-SSSSGGGNNNNSGGGGSTSGSSSYTGTNFA 68

  Fly   224 GAHPSNTNKHG---------------------KSGPA-GTGGATGARNRRALFK-KPAQKTPKVQ 265
            .|..|..:..|                     ||.|| ....:|..:.||.:|| |...|.|:..
 Frog    69 SASTSQQSNGGNTKQSKQEIHRRSARLRNTKYKSTPAVEKKVSTKGKGRRHIFKLKNPIKAPEAV 133

  Fly   266 ASTRFVRSLFHKGSYIQIGDIVSIVDSEQ-NLYYAQIRGLLVDAYCEKSAFLTWLIPTQDSPDPQ 329
            ::.....|:||||.|.||||:||:||.|. ..|||||||.:.|.||||||.|||||||..|  |:
 Frog   134 STIVTSESIFHKGLYYQIGDVVSVVDEEDGKTYYAQIRGFVQDQYCEKSAALTWLIPTMSS--PK 196

  Fly   330 EGFDPPTYLIGPDEELSRKLCYLEFVMHAPSNYYFDRSTPFP-LPDVDEYTAQRSGGYIWTRL 391
            :||||.||:|||||:|.||:..||||.||||.|:..||:||| :|...|      .|:|||.:
 Frog   197 DGFDPSTYIIGPDEDLPRKMECLEFVCHAPSEYFKSRSSPFPTIPTRPE------KGFIWTHI 253



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4214
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4210
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007227
OrthoInspector 1 1.000 - - oto105233
Panther 1 1.100 - - LDO PTHR13340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6068
SonicParanoid 1 1.000 - - X5332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.