powered by:
Protein Alignment su(sable) and YTH1
DIOPT Version :9
Sequence 1: | NP_001284753.1 |
Gene: | su(sable) / 31012 |
FlyBaseID: | FBgn0003575 |
Length: | 1325 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015432.1 |
Gene: | YTH1 / 856222 |
SGDID: | S000006311 |
Length: | 208 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 16/55 - (29%) |
Similarity: | 28/55 - (50%) |
Gaps: | 5/55 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 335 LCKFYLMDCCAKRDKCSYMH----KEFP-CKYYYLGMDCYAGDDCLFYHGEPLSE 384
:|:.:|...|.|.|:|.|:| ::.| |.::.....|....||.:.|.:|.|:
Yeast 66 VCRHWLRGLCKKNDQCEYLHEYNLRKMPECVFFSKNGYCTQSPDCQYLHIDPASK 120
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
su(sable) | NP_001284753.1 |
None |
YTH1 | NP_015432.1 |
YTH1 |
2..208 |
CDD:227416 |
16/55 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5084 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.