DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and ZC3H8

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_115883.2 Gene:ZC3H8 / 84524 HGNCID:30941 Length:291 Species:Homo sapiens


Alignment Length:346 Identity:71/346 - (20%)
Similarity:117/346 - (33%) Gaps:124/346 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EPPMPRMRSSNQDTSDQSLEGSGEGLATANPLLQSTRSSRRRKRKKEREREQKKDKEQQNRSRRD 176
            :||.|.:..:..| ||:.::         :.:......::..|.|.|.|:..||.:.        
Human     9 KPPNPALGKTATD-SDERID---------DEIDTEVEETQEEKIKLECEQIPKKFRH-------- 55

  Fly   177 ENDVSVVPGGVEDMDEYEMMNVRGGSPPPGGAAPPLSSCGQRFSGADWDM-DDGSAATGAAGLGA 240
                                          .|..|.||..::....|:|: .|....        
Human    56 ------------------------------SAISPKSSLHRKSRSKDYDVYSDNDIC-------- 82

  Fly   241 GGGGGYNSHSSYDSYS------------------DEETNGPGLMNQRRRTRRDNEKEHQRGVNNR 287
                   |..|.|:::                  :|.|...|:.:..:..::.| |..:.|..|.
Human    83 -------SQESEDNFAKELQQYIQAREMANAAQPEESTKKEGVKDTPQAAKQKN-KNLKAGHKNG 139

  Fly   288 KRRDRDRLEGGLAGSGSKRNRRDSG---EGG---------------------------------- 315
            |::...|...|....||....|:||   |.|                                  
Human   140 KQKKMKRKWPGPGNKGSNALLRNSGSQEEDGKPKEKQQHLSQAFINQHTVERKGKQICKYFLERK 204

  Fly   316 --GGGQEKMGGSNRVEPRKLELCKFYLMDCCAKRDKCSYMHKEFPCKYYYLGMDCYAGDDCLFYH 378
              .|.|.|......:|.:| |:||||:...|.:.:.|.|:|.|:|||:|:.|..||.|:.|.|.|
Human   205 CIKGDQCKFDHDAEIEKKK-EMCKFYVQGYCTRGENCLYLHNEYPCKFYHTGTKCYQGEYCKFSH 268

  Fly   379 GEPLSEQLRNVLLKHMETAPK 399
            . ||:.:.:.:|.|.::|..|
Human   269 A-PLTPETQELLAKVLDTEKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
ZC3H8NP_115883.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..75 7/61 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..179 17/86 (20%)
ZnF_C3H1 <226..246 CDD:214632 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7796
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40959
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13119
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.