DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and Cpsf4l

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_030101983.1 Gene:Cpsf4l / 52670 MGIID:1277182 Length:295 Species:Mus musculus


Alignment Length:173 Identity:35/173 - (20%)
Similarity:61/173 - (35%) Gaps:59/173 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 KLELCKFYLMDCCAKRDKCSYMHK----EFPCKYYYLGMDCYAGDDCLFYHGEPLSEQLRNVLLK 392
            ||.:||.:|...|.|.|.|.::|:    :.|..|::......:..:|||.|.:|        :||
Mouse   117 KLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKP--------VLK 173

  Fly   393 HMETAPKEILGDFKRISRDIAIVQMTRRHEQLCDQ------------------------------ 427
             ::..|....|..|.:.   .:.:....|:.||..                              
Mouse   174 -LQDCPWYNQGFCKEVG---PLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHCSLSTSHGIQQLLL 234

  Fly   428 ------LNRENTWNSI---GCGLMGKRQDHQMQQ----QQQQL 457
                  |:|::.|:::   |..|....|.|.:..    ||.:|
Mouse   235 ATLWCPLSRQSPWSTVRGGGVCLRPAAQGHTLHLRPPCQQSKL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
Cpsf4lXP_030101983.1 YTH1 <84..>215 CDD:227416 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.