DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and Clp

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster


Alignment Length:188 Identity:40/188 - (21%)
Similarity:65/188 - (34%) Gaps:66/188 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 GQEKMGGS----NRVEPRKLELCKFYLMDCCAKRDKCSYMHK----EFPCKYYYLGMDCYAGDDC 374
            |||...||    ..:...:..:||.:|...|.|.|:|.::|:    :.|..|:|...:.....:|
  Fly    48 GQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKEC 112

  Fly   375 LFYHGEPLS---------------------EQLRNVL--------------LKHMETAPKEILGD 404
            .|.|.:|.|                     :.||.||              .|||.  |...|..
  Fly   113 PFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMH--PHFELPP 175

  Fly   405 FKRISRDIAIVQMTRRHEQL--CDQLNRENTWNSIGCGLMGKRQDHQMQQQQQQLQHQ 460
            ...:.:|       :.|::|  |..           ||.:|.:. :..:|....|:|:
  Fly   176 LAELGKD-------QLHKKLPTCHY-----------CGELGHKA-NSCKQYVGSLEHR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
ClpNP_477156.1 YTH1 12..175 CDD:227416 30/128 (23%)
ZnF_C3H1 66..90 CDD:214632 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.