DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and Zc3h8

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001012090.1 Gene:Zc3h8 / 311414 RGDID:1310458 Length:305 Species:Rattus norvegicus


Alignment Length:326 Identity:67/326 - (20%)
Similarity:114/326 - (34%) Gaps:102/326 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NPLLQSTRSSRRRKRKKEREREQKKDKEQQNRSRRDENDVSVVPGGVEDMDEYEMMNVRGGSPPP 205
            ||.|....::...:|..|.:..:.::.:.:|..|:.:.|...:|      .:::.:...|     
  Rat    12 NPALGKKPAADPEERIDETDGTEVEEAQTENVKRKVKRDCEPIP------KKFKHLGHAG----- 65

  Fly   206 GGAAPPLSSCGQRFSGADWD-MDDGSAATGAAGLGAGGGGGYNSHSSYDSYSDE----------- 258
               .||.|...::....|:| ..||...               |..|.|::..|           
  Rat    66 ---TPPKSLPRKKSRSKDYDPYSDGETC---------------SQESEDNFDKELQQYIQAKEMA 112

  Fly   259 ETNGPGLMNQR----------RRTRRDNEKEHQRGVNNRKRRDRDRLEGGLAGSGSKRNRRDSGE 313
            ....|.|:.:.          ::|.:...|:.:.|:...|::...|...|....||....:.   
  Rat   113 SVAPPSLLPEESVKKAGTGDTQQTAKQKNKKSKAGLKKVKQKKMKRKWLGTGNKGSNALLKI--- 174

  Fly   314 GGGGGQEKMGGSNRVEPR---------------------------------------------KL 333
              ||.|.|..|....:||                                             |.
  Rat   175 --GGSQGKADGPEEKQPRVRMSQGFINQHTVERKGKQVCKYFLERKCIKGDQCKFDHDAEIEKKK 237

  Fly   334 ELCKFYLMDCCAKRDKCSYMHKEFPCKYYYLGMDCYAGDDCLFYHGEPLSEQLRNVLLKHMETAP 398
            |:||:|:...|.|.:.|.|:|.|:|||:|:.|..||.||.|.|.|. ||:.:.:.:|.|.::|..
  Rat   238 EMCKYYVQGYCTKGENCLYLHNEYPCKFYHTGTKCYQGDHCNFSHA-PLTAETQELLAKVLDTDK 301

  Fly   399 K 399
            |
  Rat   302 K 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
Zc3h8NP_001012090.1 ZnF_C3H1 <240..260 CDD:214632 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45093
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13119
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.