DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and Cpsf4

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_006248931.1 Gene:Cpsf4 / 304277 RGDID:620440 Length:269 Species:Rattus norvegicus


Alignment Length:275 Identity:53/275 - (19%)
Similarity:88/275 - (32%) Gaps:91/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 GQEKMGGSNRVEPRKLELCKFYLMDCCAKRDKCSYMH----KEFPCKYYYLGMDCYAGDDCLFYH 378
            |.:|.|.:         :|:|:|...|.|...|.:.|    |...||::..|: |..||.|.|.|
  Rat    32 GMDKSGAA---------VCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGL-CKKGDQCEFLH 86

  Fly   379 GEPLSE-----------QLRNVLLKHMETAPKEILGDFKRISRDIAIVQMTRRHEQLCDQLNREN 432
            ...:::           :..|.....:...|:..:.|.....|...      :|..||   ...:
  Rat    87 EYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFC------KHGPLC---RHRH 142

  Fly   433 TWNSI-------------GCGLMGKRQDHQMQQQQQQLQHQQLQQQQEQQQTQQQAAADGGGCIP 484
            |...|             .|..|..|.:..|...:|....||.|...:|..              
  Rat   143 TRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPTKQSN-------------- 193

  Fly   485 SLLDMVINPPLSENKRKSRWTEKMGAKAAAGAAGSSERDSTSPDAKPLPPHLDLANLSHVLSAEN 549
                   ||||..:....:.|.:                ::||:.:..|      .:..|:.::|
  Rat   194 -------NPPLQRSSSLIQLTSQ----------------NSSPNQQRAP------QVIGVMQSQN 229

  Fly   550 MAKLNKLGITNLEQM 564
            .:..|: |...|||:
  Rat   230 SSAGNR-GPRPLEQV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
Cpsf4XP_006248931.1 YTH1 <25..211 CDD:227416 43/234 (18%)
COG5222 <198..>258 CDD:227547 11/69 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.