DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and ZC3H3

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_016868737.1 Gene:ZC3H3 / 23144 HGNCID:28972 Length:1076 Species:Homo sapiens


Alignment Length:561 Identity:107/561 - (19%)
Similarity:176/561 - (31%) Gaps:150/561 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DHASSIELAIAN-------ALKKKGIEP-----PMP-----------RMRSSNQDTSDQSLEGSG 134
            ||||.:...::.       |:...|::|     |:.           |.|||.....|:. .|:.
Human   530 DHASQLSPVLSRSPSGDRPAVGHSGLKPLSGETPLSAYKVKSRTKIIRRRSSTSLPGDKK-SGTS 593

  Fly   135 EGLATANPLLQSTRSSRRRKRKKEREREQKKDKEQQNRSR-------------RDENDVSVV--- 183
            ......:.|....|.:.|.|.....::...|...|....|             ::.:.:..|   
Human   594 PAATAKSHLSLRRRQALRGKSSPVLKKTPNKGLVQVTTHRLCRLPPSRAHLPTKEASSLHAVRTA 658

  Fly   184 PGGVEDMDEYEMMNVRGGSP---PP---------------------GGAAPPLSSCGQRFSGADW 224
            |........|.::.....||   ||                     ....|..|..|:...|:.|
Human   659 PTSKVIKTRYRIVKKTPASPLSAPPFPLSLPSWRARRLSLSRSLVLNRLRPVASGGGKAQPGSPW 723

  Fly   225 DMDDGSAATGAAGLGAGGGGGYNSHSSYDSYSDEETNGPGLMNQRRRTRRDNEKEHQRGVNNRKR 289
            ....|....        ||..|...::..|.:..:.:..|.....|..|.|......|.:.:|  
Human   724 WRSKGYRCI--------GGVLYKVSANKLSKTSGQPSDAGSRPLLRTGRLDPAGSCSRSLASR-- 778

  Fly   290 RDRDRLEGGLAGSGSKRNRRDSGEGGGGGQEKMGGSNRVE-------PRKLELCKFYLMDCCAKR 347
                .::..||.....|.||:..:.......:.|..||.|       |.|:.:|..::...|.|.
Human   779 ----AVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYIHDPEKVAVCTRFVRGTCKKT 839

  Fly   348 D-KCSYMH----KEFP-CKYYYLGMDCYAGDDCLFYHGEPLSEQLRNVLLKHMETAPK-EILGDF 405
            | .|.:.|    ::.| |.|:..|: | :..:|      |.|         |:..:.| |:..||
Human   840 DGTCPFSHHVSKEKMPVCSYFLKGI-C-SNSNC------PYS---------HVYVSRKAEVCSDF 887

  Fly   406 KRISRDIAIVQMTRRHEQLCDQLNRENTW-NSIGCGLMGKRQDHQMQQQQQQLQHQQLQQQQEQQ 469
            .:....:. .:..::|..||....|.... ....|.|:     |:.|::..:.............
Human   888 LKGYCPLG-AKCKKKHTLLCPDFARRGACPRGAQCQLL-----HRTQKRHSRRAATSPAPGPSDA 946

  Fly   470 QTQQQAAADGGGCIPSLLDMVINPPLSENKRKSRWTEKMGAKAAAGAAG-----------SSERD 523
            ..:.:.:|..|...|           |.::|.:|.|....|..||..|.           ||.:.
Human   947 TARSRVSASHGPRKP-----------SASQRPTRQTPSSAALTAAAVAAPPHCPGGSASPSSSKA 1000

  Fly   524 STSPDAKPLPPHLDLANLSH--------VLSAENMAKLNKL 556
            |:|..:...||    |:|.|        .|:|....:|.||
Human  1001 SSSSSSSSSPP----ASLDHEAPSLQEAALAAACSNRLCKL 1037



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.