DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and cpsf-4

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001023126.1 Gene:cpsf-4 / 178151 WormBaseID:WBGene00044329 Length:302 Species:Caenorhabditis elegans


Alignment Length:179 Identity:38/179 - (21%)
Similarity:56/179 - (31%) Gaps:83/179 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 HQRGVNNRKRRDRDRLEGGLAGSGSKRNRRDSGEGGGGGQEKM---GGS---NRVEPRKLELCKF 338
            :|||:.....||.||       ||....|::        :.||   |.:   ..::..|..:||.
 Worm    35 NQRGMKEAPFRDLDR-------SGKAVCRKN--------KLKMCPFGPTCPLRHIDGEKAVVCKH 84

  Fly   339 YLMDCCAKRDKCSYMH---------------------KEFP------------CKYY-------- 362
            :|...|.|.|:|.::|                     :|.|            |.:|        
 Worm    85 WLRGLCKKGDQCEFLHEYDLTKMPECFFFSKYSACSNRECPFRHIDPETKMKDCPWYDRGFCRHG 149

  Fly   363 ---------------YLGMDCYAGDDCLFYH---GEPLSEQLRNVLLKH 393
                           ||...|..|.||.:.|   |.|..|   |:.:.|
 Worm   150 PYCKHRHRRRAVCPNYLAGFCLQGPDCQYAHPSFGLPSFE---NIAVSH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
cpsf-4NP_001023126.1 YTH1 <66..187 CDD:227416 22/120 (18%)
ZnF_C3H1 77..102 CDD:214632 9/24 (38%)
ZnF_C3H1 133..158 CDD:214632 2/24 (8%)
ZnF_C3H1 157..181 CDD:214632 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.