DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(sable) and CPSF4

DIOPT Version :9

Sequence 1:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_011514057.1 Gene:CPSF4 / 10898 HGNCID:2327 Length:274 Species:Homo sapiens


Alignment Length:272 Identity:53/272 - (19%)
Similarity:89/272 - (32%) Gaps:80/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 GQEKMGGSNRVEPRKLELCKFYLMDCCAKRDKCSYMH----KEFPCKYYYLGMDCYAGDDCLFYH 378
            |.:|.|.:         :|:|:|...|.|...|.:.|    |...||::..|: |..||.|.|.|
Human    32 GMDKSGAA---------VCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGL-CKKGDQCEFLH 86

  Fly   379 GEPLSE-----------QLRNVLLKHMETAPKEILGDFKRISRDIAIVQMTRRHEQLCDQLNREN 432
            ...:::           :..|.....:...|:..:.|.....|...      :|..||    |..
Human    87 EYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFC------KHGPLC----RHR 141

  Fly   433 TWNSIGC----------GLMGKRQDHQMQQQQQQLQHQQLQQQQEQQQTQQQAAADGGGCIPSLL 487
            ....:.|          |...|.....:...:.:|.....:|....||||..|....        
Human   142 HTRRVICVNYLVGFCPEGPSCKFMQLLVTSPRFELPMGTTEQPPLPQQTQPPAKQSN-------- 198

  Fly   488 DMVINPPLSENKRKSRWTEKMGAKAAAGAAGSSERDSTSPDAKPLPPHLDLANLSHVLSAENMAK 552
                ||||..:....:.|.:                ::||:.:..|      .:..|:.::|.:.
Human   199 ----NPPLQRSSSLIQLTSQ----------------NSSPNQQRTP------QVIGVMQSQNSSA 237

  Fly   553 LNKLGITNLEQM 564
            .|: |...|||:
Human   238 GNR-GPRPLEQV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(sable)NP_001284753.1 None
CPSF4XP_011514057.1 YTH1 <25..>161 CDD:227416 30/148 (20%)
COG5222 <231..>263 CDD:227547 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.