DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and CASP6

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001217.2 Gene:CASP6 / 839 HGNCID:1507 Length:293 Species:Homo sapiens


Alignment Length:305 Identity:80/305 - (26%)
Similarity:130/305 - (42%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 NAPEPDAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGIALIINQQKFHRNVSRDNMKFL 281
            |..|.||      ..|:|: .|..:.|        |:.....|||||.|.::|..:::       
Human    18 NMTETDA------FYKREM-FDPAEKY--------KMDHRRRGIALIFNHERFFWHLT------- 60

  Fly   282 SPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLV-RDSLVVFILSH 345
                |..|.||..|::.|...||.:|:.|:.::::....::.:|......|.. .|..|...|||
Human    61 ----LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSH 121

  Fly   346 GFEEAVYASNSIAMKITDIEDLLCSY-----DTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVT 405
            |....:||.::   || :|:.|...:     .:|..|||:.|||||:.. .|......|..:|..
Human   122 GEGNHIYAYDA---KI-EIQTLTGLFKGDKCHSLVGKPKIFIIQACRGN-QHDVPVIPLDVVDNQ 181

  Fly   406 TVSPDQHI---------------DMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIA 455
            |...|.:|               |.|...|...||.:.|.|..|||:|..||:.:.:..:|....
Human   182 TEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFT 246

  Fly   456 DILTIVTNEVSKKR-------GSNDESMVPNVKSTFRQHVYFPPR 493
            ::||:|..:||::|       .:..:..||...|...:.::|.|:
Human   247 ELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 71/267 (27%)
CASP6NP_001217.2 CASc 37..290 CDD:214521 72/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.