DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and CASP4

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001216.1 Gene:CASP4 / 837 HGNCID:1505 Length:377 Species:Homo sapiens


Alignment Length:369 Identity:75/369 - (20%)
Similarity:136/369 - (36%) Gaps:74/369 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LLDWLTRRSIKLGDINAAGSDVQLLVGHLKSNGLQAQANLLKD--TIISNAPEPDAAGTAAMAVK 232
            :|:|......|..|.... ..|:::...::.....|...||:.  .|...:|...|.........
Human    34 VLNWKEEEKKKYYDAKTE-DKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPP 97

  Fly   233 QEIESDNQQSYCSTQIDALKLTRENA-------------GIALIINQQKFHRNVSRDNMKFLSPD 284
            :..||.:....|..: :.|:|.:|.|             .:||||...:|              |
Human    98 ESGESTDALKLCPHE-EFLRLCKERAEEIYPIKERNNRTRLALIICNTEF--------------D 147

  Fly   285 PLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVR--DSLVVFILSHGF 347
            .|..|:|.|.|...:.|:...:.|:|:..:|:....:...:|:...|...:  ||..:.::|||.
Human   148 HLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGI 212

  Fly   348 EEAVYASNSIAMKITDIEDLLCSYDTLYY------------KPKLLIIQAC----QEKLVHKKKP 396
            .|.:..:.....|    .|:|. |||::.            |||::|:|||    :.:|..:..|
Human   213 LEGICGTVHDEKK----PDVLL-YDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSP 272

  Fly   397 NELFRIDVTTVSPDQHI------------DMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRS 449
            ..|   :|.:....:::            |.:...|:.....:.|.:..||.||..|.....:.|
Human   273 ASL---EVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYS 334

  Fly   450 ASEHIADILTIVTNEVSKKRGSNDESMVPNVK--STFRQHVYFP 491
            ...|:.::...|.......|.   ::.:|.::  |..|....||
Human   335 WCCHLEEVFRKVQQSFETPRA---KAQMPTIERLSMTRYFYLFP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 60/285 (21%)
CASP4NP_001216.1 Required for LPS-binding. /evidence=ECO:0000250|UniProtKB:P70343 1..59 5/25 (20%)
CARD_CASP1-like 5..81 CDD:260036 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 4/19 (21%)
CASc 126..375 CDD:214521 55/273 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.