DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and CASP1

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001244047.1 Gene:CASP1 / 834 HGNCID:1499 Length:404 Species:Homo sapiens


Alignment Length:310 Identity:69/310 - (22%)
Similarity:121/310 - (39%) Gaps:69/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVGHLKSNGLQAQANLL--KDT--IISNAPEPDAA-GTAAMAVKQEIESDNQQSYCSTQIDALKL 253
            |.|.|..:..|...|.|  :|:  ::|:.|.|.|. ...||....  .|:.....||.: :|.::
Human    83 LAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSS--GSEGNVKLCSLE-EAQRI 144

  Fly   254 TRENAG-------------IALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSS 305
            .::.:.             :||||..::|              |.:.||.|.:||...:..:..:
Human   145 WKQKSAEIYPIMDKSSRTRLALIICNEEF--------------DSIPRRTGAEVDITGMTMLLQN 195

  Fly   306 MGYNVEAYDNVDHMGIIERIRSACDR--SLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLL 368
            :||:|:...|:....:...:.:...|  ....||..:..:|||..|.: .....:.::.||..|.
Human   196 LGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGI-CGKKHSEQVPDILQLN 259

  Fly   369 CSYD--------TLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPD--------------- 410
            ..::        :|..|||::|||||:     ...|..::..|...||.:               
Human   260 AIFNMLNTKNCPSLKDKPKVIIIQACR-----GDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIK 319

  Fly   411 -QHI--DMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADI 457
             .||  |.:...|:.....:.||...||.|||.|.:.:...:.|..:.:|
Human   320 KAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 52/247 (21%)
CASP1NP_001244047.1 CARD_CASP1-like 5..87 CDD:260036 2/3 (67%)
CASc 153..402 CDD:214521 52/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.