DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Casp9

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_113820.1 Gene:Casp9 / 58918 RGDID:61867 Length:454 Species:Rattus norvegicus


Alignment Length:323 Identity:78/323 - (24%)
Similarity:131/323 - (40%) Gaps:66/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LLKDTIISNAPEPDAAGTAA---MAVKQEIESDNQQSYCSTQIDALKLTRENAGIALIINQQKFH 270
            |..:.:....|.|...|:..   :....:||.....:|        .|..:..|..||||     
  Rat   154 LRPEVLTPETPRPVDIGSGRAHDVCTPGKIERHADMAY--------TLDSDPCGHCLIIN----- 205

  Fly   271 RNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRS-LV 334
                  |:.|.....|..|.|:.||.|:|...|..:.:.||..:::....::..:.....|. ..
  Rat   206 ------NVNFCPSSGLSTRIGSHVDCEKLQHRFCWLRFMVEVKNDLTAKKMVTALMEMAHRDHRA 264

  Fly   335 RDSLVVFILSHG-------FEEAVYASNSIAMKITDIEDLL----CSYDTLYYKPKLLIIQAC-- 386
            .|..||.|||||       |..|||.::..::.|..|.::.    |  .:|..||||..||||  
  Rat   265 LDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIERIVNIFNGTGC--PSLGGKPKLFFIQACGG 327

  Fly   387 --------------QEK----------LVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAA 427
                          |:|          :.:::.|..|.::|..:..|... |:|.:.||..|:.:
  Rat   328 EQKDHGFEVAFTSSQDKAFDSDSEPDAVPYQEGPRTLDQLDAVSSLPTPS-DILVSYSTFPGFVS 391

  Fly   428 LRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVYF 490
            .|..::|||:|.:|...:::.:.||.:..:|..|.|.||:|   .....:|...:..|:.::|
  Rat   392 WRDKKSGSWYIETLDGVLEQWARSEDLQSLLLRVANAVSEK---GVYKQIPGCFNFLRKKLFF 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 71/277 (26%)
Casp9NP_113820.1 CARD_CASP9 19..90 CDD:176740
CASc 190..452 CDD:237997 72/287 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.