DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and casp23

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001103182.1 Gene:casp23 / 563034 ZFINID:ZDB-GENE-071004-27 Length:446 Species:Danio rerio


Alignment Length:309 Identity:68/309 - (22%)
Similarity:116/309 - (37%) Gaps:91/309 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 QEIESDNQQSYCSTQIDALKLTRENAGI-------------ALIINQQKFHRNVSRDNMKFLSPD 284
            |.:...:....|:::..|.||..|...|             ||:||...|..||           
Zfish   182 QSVTEPDPLKPCTSEFKAEKLMTEGKCIYPVKDKSPQRKRLALLINNVDFKDNV----------- 235

  Fly   285 PLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRS--LVRDSLVVFILSHGF 347
                |.|.|.|:..:..:...:||:|....::...|:...:|....|.  ...||..|.::|||.
Zfish   236 ----RTGADKDELSMERLLKGLGYSVVTLRDLSAQGMSTAMRDFSQRKEHADSDSCFVVLMSHGD 296

  Fly   348 EE---AVYASNSIAMKITDIEDLLCSYDTLYY------------KPKLLIIQACQ---------- 387
            |.   .::.|:|        :|.:...|.::.            |||:::||:|:          
Zfish   297 ESGICGIFDSSS--------QDDVFPPDEIFKCLNTPNCAGLRDKPKIILIQSCRGGKPGNVDVP 353

  Fly   388 -------EKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAI 445
                   .:..||:|....||    :.:||          ||    :.|:.:.||.||..|.:..
Zfish   354 DSVPIRGTRREHKEKDFCCFR----SSTPD----------TV----SYRNKEKGSHFIQDLVEIF 400

  Fly   446 DRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVYFPPRL 494
            :|.:..:.|.::...|   :.|.|.::||.|....::|..:..|..|.|
Zfish   401 NRHAYEDDIEELFRKV---IMKFRETHDEQMPCKERTTLCKKFYLFPGL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 63/286 (22%)
casp23NP_001103182.1 CASc 210..444 CDD:320727 59/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.