DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and casp6a

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001018333.1 Gene:casp6a / 552927 ZFINID:ZDB-GENE-030825-4 Length:298 Species:Danio rerio


Alignment Length:329 Identity:93/329 - (28%)
Similarity:142/329 - (43%) Gaps:61/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVGHLKSNGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQ---EIESDNQQSYCSTQIDALKLTR 255
            :..|.||:|             |.|.|.|:| :|...|::   |.:|.||..:.........:..
Zfish     1 MASHTKSDG-------------SAAVEKDSA-SAGQTVEENLTETDSFNQSIFSMDPNQEYDMNH 51

  Fly   256 ENAGIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMG 320
            :..|:|||.|.:.|...:.           |..|.||:.|||.||..|..:.:.|:|:|:.....
Zfish    52 KRRGMALIFNHENFFWKLG-----------LGYRSGTNADKENLIRRFRELNFEVKAFDDYKRHE 105

  Fly   321 IIERIRSACDRSLV-RDSLVVFILSHGFEEAVYASNSIAMKITDIEDLL----CSYDTLYYKPKL 380
            ::.:|..|.....| .|.||...||||....||| |...::|.:|.||.    |.  :|..|||:
Zfish   106 VLSKITEAAAADHVDADCLVCVFLSHGENGHVYA-NDGQIEIPEITDLFKGDKCR--SLVGKPKI 167

  Fly   381 LIIQACQEKLVHKKKPNELFRIDV--TTVSPDQHI------------DMLRAMSTVNGYAALRHT 431
            .|.|||:    ..|..:.:..:||  :.|:.|..:            |.:...|...||.:.|.|
Zfish   168 FIWQACR----GDKHDDPVTPMDVVDSQVTNDMVVDAGVLYTLPAGADFIMCYSVAEGYYSHRET 228

  Fly   432 QTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVS-------KKRGSNDESMVPNVKSTFRQHVY 489
            ..|||:|..||:.:.|..:....|:|||:|..:||       |.|.:..:..||...|...:.::
Zfish   229 VNGSWYIQDLCEILRRYGSELEFAEILTLVNRKVSLRSVLNCKDRSAVGKKQVPCFASMLTKKLF 293

  Fly   490 FPPR 493
            |.|:
Zfish   294 FRPK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 77/265 (29%)
casp6aNP_001018333.1 CASc 47..294 CDD:237997 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.