DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and casp6

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001011068.1 Gene:casp6 / 496478 XenbaseID:XB-GENE-482797 Length:304 Species:Xenopus tropicalis


Alignment Length:323 Identity:84/323 - (26%)
Similarity:145/323 - (44%) Gaps:58/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GHLKSNGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGI 260
            |.::.:...|..|..:.   :|..|.|.      ...:.:|.|....|        |:|.:..|:
 Frog    13 GQIEKDSSSASQNKEQK---ANVAETDG------WTSRTLELDPSAEY--------KMTHKRRGL 60

  Fly   261 ALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERI 325
            |||.|.:.|:..:.           |..|.||:.|...|..:.:.:|::|:.|.|:..:.|:|:|
 Frog    61 ALIFNHEDFYWQLR-----------LGSRRGTNTDSMNLNRILTDLGFDVQNYYNLRTLDILEKI 114

  Fly   326 R--SACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSY-----DTLYYKPKLLII 383
            :  |..|.|.....|.|| ||||.:..:|:.:|    :.||::|..|:     ::|..|||:.|.
 Frog   115 QEASTADHSNADCFLCVF-LSHGEDRHIYSYDS----LIDIQELTNSFKGDKCESLVGKPKIFIF 174

  Fly   384 QACQ-EKLVHKKKP-NELFRIDVTTVSP---------DQHIDMLRAMSTVNGYAALRHTQTGSWF 437
            |||: ||..:...| :|...:.:|.::.         ....|.:...|...||.:.|.|..|||:
 Frog   175 QACRGEKHDNPVLPTDETDSVTLTNITEVDAASLYTLPAGADFIMCYSVAEGYYSHRETVNGSWY 239

  Fly   438 IGSLCDAIDRRSASEHIADILTIVTNEVSKKRGS--ND-----ESMVPNVKSTFRQHVYFPPR 493
            |..||:.:...:||....:|||:|..:||::..:  ||     :..:|...|...:.::..|:
 Frog   240 IQDLCEVLKAHAASLEFTEILTLVNRKVSQRSVAFCNDPKAIGKKQIPCFSSMLTKKLFLKPK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 74/264 (28%)
casp6NP_001011068.1 CASc 51..300 CDD:237997 75/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.