Sequence 1: | NP_477249.3 | Gene: | Dredd / 31011 | FlyBaseID: | FBgn0020381 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157976.1 | Gene: | casp2 / 373118 | ZFINID: | ZDB-GENE-030825-3 | Length: | 437 | Species: | Danio rerio |
Alignment Length: | 258 | Identity: | 67/258 - (25%) |
---|---|---|---|
Similarity: | 115/258 - (44%) | Gaps: | 67/258 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 GIALIINQQKF-HRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGII 322
Fly 323 ERIRSACDR------SLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDT-----LYY 376
Fly 377 KPKLLIIQAC--------------QEKLV------------------HKKKPNELFRIDVTTVSP 409
Fly 410 DQHIDMLRAMSTVNGY--AALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRG 470 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dredd | NP_477249.3 | CASc | 252..492 | CDD:294037 | 67/258 (26%) |
casp2 | XP_005157976.1 | CARD_CASP2 | 7..94 | CDD:260040 | |
CASc | 158..430 | CDD:237997 | 67/258 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3573 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10454 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |