DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and casp2

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_005157976.1 Gene:casp2 / 373118 ZFINID:ZDB-GENE-030825-3 Length:437 Species:Danio rerio


Alignment Length:258 Identity:67/258 - (25%)
Similarity:115/258 - (44%) Gaps:67/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 GIALIINQQKF-HRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGII 322
            |:||:::..:| ..|...|         :||  |.:||:|.|..:|:.:.:.|..:.::    ..
Zfish   167 GLALVLSNVRFDSANTDLD---------IRR--GGEVDEETLRRLFTELDFKVSLHRDL----TA 216

  Fly   323 ERIRSACDR------SLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDT-----LYY 376
            |.:|...::      ....|..||.:||||.|.:||.::.   ::.:::.:...:|.     |..
Zfish   217 EAMRRCLEQFAQQQEHAAYDCAVVCLLSHGVEGSVYGTDG---QLLELDWVFEVFDNARCPLLQN 278

  Fly   377 KPKLLIIQAC--------------QEKLV------------------HKKKPNELFRIDVTTVSP 409
            |||:..||||              ||:..                  .||:..|..|:   .|..
Zfish   279 KPKMFFIQACRGEEMDNGVDQLDGQERTQSPGCEQRDAGREGERDNREKKEEKERERL---RVKL 340

  Fly   410 DQHIDMLRAMSTVNGY--AALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRG 470
            .|..||:...:|:.|:  ||:|:|:.|||||..|..||.:|:.:.|::|||..|..::..:.|
Zfish   341 PQRSDMICGFATLKGFSTAAMRNTKKGSWFIQELNTAIRQRANNTHLSDILVQVNGQIKSREG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 67/258 (26%)
casp2XP_005157976.1 CARD_CASP2 7..94 CDD:260040
CASc 158..430 CDD:237997 67/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.