DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Pea15

DIOPT Version :10

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001013249.1 Gene:Pea15 / 364052 RGDID:1306055 Length:130 Species:Rattus norvegicus


Alignment Length:146 Identity:29/146 - (19%)
Similarity:53/146 - (36%) Gaps:69/146 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 SNSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQHIDMLRA 418
            :|:|.::  |:|.|.               .||:|.:..:|..      ::||.|          
  Rat    12 TNNITLE--DLEQLK---------------SACKEDIPSEKSE------EITTGS---------- 43

  Fly   419 MSTVNGYAALRHTQTGSWFIGSLCDA---IDRRSAS--EHI------ADILTIVTNEVSK--KRG 470
                            :||  |..::   :|:.:.|  |||      .|:||:|.:..::  |..
  Rat    44 ----------------AWF--SFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKIS 90

  Fly   471 SNDE-----SMVPNVK 481
            ..||     :.:|:.|
  Rat    91 EEDELDTKLTRIPSAK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:444667 29/146 (20%)
Pea15NP_001013249.1 DED_PEA15 2..85 CDD:260045 24/123 (20%)
Microtubule-binding. /evidence=ECO:0000255 98..107 2/9 (22%)
Microtubule-binding. /evidence=ECO:0000255 122..129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.