DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Pea15

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001013249.1 Gene:Pea15 / 364052 RGDID:1306055 Length:130 Species:Rattus norvegicus


Alignment Length:146 Identity:29/146 - (19%)
Similarity:53/146 - (36%) Gaps:69/146 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 SNSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQHIDMLRA 418
            :|:|.::  |:|.|.               .||:|.:..:|..      ::||.|          
  Rat    12 TNNITLE--DLEQLK---------------SACKEDIPSEKSE------EITTGS---------- 43

  Fly   419 MSTVNGYAALRHTQTGSWFIGSLCDA---IDRRSAS--EHI------ADILTIVTNEVSK--KRG 470
                            :||  |..::   :|:.:.|  |||      .|:||:|.:..::  |..
  Rat    44 ----------------AWF--SFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKIS 90

  Fly   471 SNDE-----SMVPNVK 481
            ..||     :.:|:.|
  Rat    91 EEDELDTKLTRIPSAK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 29/146 (20%)
Pea15NP_001013249.1 DED_PEA15 2..85 CDD:260045 24/123 (20%)
Microtubule-binding. /evidence=ECO:0000255 98..107 2/9 (22%)
Microtubule-binding. /evidence=ECO:0000255 122..129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.