DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Damm

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:118/270 - (43%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 QEIESDNQQSYCSTQIDA-----LKLTRENAGIAL-IINQQKFHRNVSRDNMKFLSPDPLRRRDG 291
            |:||    :.|.|.:::|     |.|..:....|: |:|.::|.:            |....|.|
  Fly    10 QKIE----RLYDSNRVNAEPGQGLDLNEKLKPPAVYILNHEQFPQ------------DSQLNRKG 58

  Fly   292 TDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDS-LVVFILSHG-FEEAVYAS 354
            :..|...|.:.|.|:...||...|.....:..:::....:...:|: .|:|||||| .:|.:.|.
  Fly    59 SSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILAC 123

  Fly   355 NSIAMKITDIEDLLCSY---DTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQHIDML 416
            :.....:.|  |:|...   .||..|||:||:|||:..|          |.|...::.:.:|   
  Fly   124 DHREYHLDD--DVLFPLFRNPTLSGKPKILIVQACKGPL----------RADAKKMNNEPYI--- 173

  Fly   417 RAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVK 481
            :..|...||.:.|:...||.||.:||:|:|:...:.....|...|..||.::........||:.:
  Fly   174 KCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAEVERRSTMTGSKQVPSEE 238

  Fly   482 S-TFRQHVYF 490
            | .|.:..||
  Fly   239 SHNFDKPFYF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 64/246 (26%)
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.