DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Casp14

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001178705.1 Gene:Casp14 / 299587 RGDID:1311781 Length:246 Species:Rattus norvegicus


Alignment Length:252 Identity:61/252 - (24%)
Similarity:109/252 - (43%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LSPDPL-------------------RRRDGTDVDKERLIEVF------SSMGYNVEAYDNVDHMG 320
            ::|.||                   :.|:|::||.:.|..:|      |:|..:..|...:|.|.
  Rat     6 INPQPLQEERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYLKFESTMKRDPTAQQFLDDMD 70

  Fly   321 ----IIERIRS--ACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLL----CSYDTLY 375
                .||..:.  :|        ..|.:::||.|..:...:...:::.|:.::|    |.  .|.
  Rat    71 EFQQTIENWKEPVSC--------AFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKNCK--ALR 125

  Fly   376 YKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQ------HIDMLRAMSTVNGYAALRHTQTG 434
            .|||:.|||||:.:  |:....||...::..:....      :.||:...|||.|:.:.||.|.|
  Rat   126 GKPKVYIIQACRGE--HRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFLSYRHDQKG 188

  Fly   435 SWFIGSLCDAI--DRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVY 489
            |.||.:|.|..  .:.|.:|.:.:|..::.|....:.| ....:.|.::||.|:.:|
  Rat   189 SGFIQTLTDVFIHKKGSITELLEEITRLMANTEVMQEG-KPRKVNPEIQSTLRKKLY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 61/252 (24%)
Casp14NP_001178705.1 CASc 10..246 CDD:237997 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.