DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Casp3

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_037054.1 Gene:Casp3 / 25402 RGDID:2275 Length:277 Species:Rattus norvegicus


Alignment Length:268 Identity:74/268 - (27%)
Similarity:115/268 - (42%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 KLTRENAGIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNV 316
            |:.....|:.:|||.:.||::..           :..|:|||||...|.|.|.::.|.|...:::
  Rat    38 KMDYPEMGLCIIINNKNFHKSTG-----------MSARNGTDVDAANLRETFMALKYEVRNKNDL 91

  Fly   317 DHMGIIERIRSAC--DRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSY-----DTL 374
            ....|:|.:.|..  |.| .|.|.|..|||||.|..::.:|.    ..|::.|...:     .:|
  Rat    92 TREEIMELMDSVSKEDHS-KRSSFVCVILSHGDEGVIFGTNG----PVDLKKLTSFFRGDYCRSL 151

  Fly   375 YYKPKLLIIQACQ---------------EKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNG 424
            ..||||.|||||:               :.:..:|.|.|              .|.|.|.||..|
  Rat   152 TGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVE--------------ADFLYAYSTAPG 202

  Fly   425 YAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGS-------NDESMVPNVKS 482
            |.:.|:::.|||||.|||..:...:.......|||.|..:|:.:..|       :.:..:|.:.|
  Rat   203 YYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVS 267

  Fly   483 TFRQHVYF 490
            ...:.:||
  Rat   268 MLTKELYF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 74/268 (28%)
Casp3NP_037054.1 CASc 37..277 CDD:214521 74/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.