DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Casp6

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_033941.3 Gene:Casp6 / 12368 MGIID:1312921 Length:276 Species:Mus musculus


Alignment Length:280 Identity:71/280 - (25%)
Similarity:131/280 - (46%) Gaps:43/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 YCSTQI----DALKLTRENAGIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVF 303
            |.|.::    :..|:..:..|:|||.|.::|..:::           |..|.||:.|::.|...|
Mouse     8 YKSREVFDPAEQYKMDHKRRGVALIFNHERFFWHLT-----------LPERRGTNADRDNLTRRF 61

  Fly   304 SSMGYNVEAYDNVDHMGIIERIRSACDRSLV-RDSLVVFILSHGFEEAVYASNSIAMKITDIEDL 367
            |.:|:.|:.::::....::.:|......|.: .|..:...||||....|||.:: .::|..:..|
Mouse    62 SDLGFEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSHGEGNHVYAYDA-KIEIQTLTGL 125

  Fly   368 L----CSYDTLYYKPKLLIIQACQ-----------EKLVHK-KKPNELFRIDVTTV-SPDQHIDM 415
            .    |  .:|..|||:.|||||:           :.:.|: .|.:.:.::|..:| :.....|.
Mouse   126 FKGDKC--QSLVGKPKIFIIQACRGSQHDVPVVPLDMVDHQTDKLDNVTQVDAASVYTLPAGADF 188

  Fly   416 LRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKR-------GSND 473
            |...|...||.:.|.|..|||:|..||:.:.|..:|....::||:|..:||::|       .:..
Mouse   189 LMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQRRVDFCKDPDAIG 253

  Fly   474 ESMVPNVKSTFRQHVYFPPR 493
            :..||...|...:.::|.|:
Mouse   254 KKQVPCFASMLTKKLHFCPK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 68/264 (26%)
Casp6NP_033941.3 CASc 20..272 CDD:214521 68/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.