DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Casp14

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_033939.1 Gene:Casp14 / 12365 MGIID:1335092 Length:257 Species:Mus musculus


Alignment Length:233 Identity:57/233 - (24%)
Similarity:101/233 - (43%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 RRRDGTDVDKERLIEVF------SSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDSLVVFILSH 345
            :.|:|::||.|.|..:|      |:|..:..|...::.:...::.....:..:  ....|.:::|
Mouse    31 KAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFLEELDEFQQTIDNWEEPV--SCAFVVLMAH 93

  Fly   346 GFEEAVYASNSIAMKITDIEDLL----CSYDTLYYKPKLLIIQACQEKLVHKKKPNELFR----- 401
            |.|..:...:...:::.|:.::|    |.  .|..|||:.|||||:.:   .:.|.|..|     
Mouse    94 GEEGLLKGEDEKMVRLEDLFEVLNNKNCK--ALRGKPKVYIIQACRGE---HRDPGEELRGNEEL 153

  Fly   402 ----------IDVTTVSPDQ---HIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSAS-- 451
                      :.|...:|..   :.|.|...|||.||.:.||.:.||.||.:|.|....:..|  
Mouse   154 GGDEELGGDEVAVLKNNPQSIPTYTDTLHIYSTVEGYLSYRHDEKGSGFIQTLTDVFIHKKGSIL 218

  Fly   452 EHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVY 489
            |...:|..::.|....:.| ....:.|.|:||.|:.:|
Mouse   219 ELTEEITRLMANTEVMQEG-KPRKVNPEVQSTLRKKLY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 57/233 (24%)
Casp14NP_033939.1 CASc 10..257 CDD:237997 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.