DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and Casp12

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_036010474.1 Gene:Casp12 / 12364 MGIID:1312922 Length:425 Species:Mus musculus


Alignment Length:409 Identity:81/409 - (19%)
Similarity:142/409 - (34%) Gaps:129/409 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 IKLGD-----INAAGSDVQ-----------LLVGHLKSNGLQAQANLLKDTIISNAPEPDAAGTA 227
            :|:|:     :|.|.:.|:           :..||:.::  |.|.:|.......:.|:.....::
Mouse    48 LKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANS--QEQLSLQFSNDEDDGPQKICTPSS 110

  Fly   228 AMAVKQEIESDNQQ-----------------SYCSTQI-DALKL-------------------TR 255
            ....|:::|.|..:                 ...|::: |.|||                   ..
Mouse   111 PSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAKEIYPVM 175

  Fly   256 ENAG---IALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVD 317
            |..|   :||||..:||              |.|..||..|.|...:.|:..::||:|...:|:.
Mouse   176 EKEGRTRLALIICNKKF--------------DYLFDRDNADTDILNMQELLENLGYSVVLKENLT 226

  Fly   318 HMGIIERIRSACDR--SLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLY----- 375
            ...:...:.....|  ....||..:..:|||..|.:........|...:.|     ||::     
Mouse   227 AQEMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHD-----DTIFKIFNN 286

  Fly   376 -------YKPKLLIIQAC----------------------QEKLVHKKKPNELFRIDVTTVSPDQ 411
                   .|||:||:|||                      :|:::..|..|.:.:..|.|     
Mouse   287 SNCRSLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVET----- 346

  Fly   412 HIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTN--EVSKKRGSNDE 474
              |.:...|:.....:.:..:|||.||..|.|...:.....|:.:|...|.:  ||     ..:.
Mouse   347 --DFIAFKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEV-----PGEL 404

  Fly   475 SMVPNVK--STFRQHVYFP 491
            :.:|.::  |..|....||
Mouse   405 TQMPTIERVSMTRYFYLFP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 64/302 (21%)
Casp12XP_036010474.1 CARD_CASP1-like 12..94 CDD:260036 10/47 (21%)
CASc 172..423 CDD:214521 60/281 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.