DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and CASP12

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001177945.2 Gene:CASP12 / 100506742 HGNCID:19004 Length:341 Species:Homo sapiens


Alignment Length:332 Identity:67/332 - (20%)
Similarity:113/332 - (34%) Gaps:97/332 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 IISNAPE--PDAAGTAAMAVK--------------QEIESDNQQSYCSTQIDALKLTRENAGIAL 262
            ::|||..  .|...||.:|.|              .:|.||.:              ||.....|
Human    51 VVSNAENLVDDITETAQIAGKIFREHLWNSKKQLSSDISSDGE--------------REANMPGL 101

  Fly   263 IINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIR- 326
            .|..::|:.              |..|:|:::|...:.::..::||:|...:|:....:...:| 
Human   102 NIRNKEFNY--------------LHNRNGSELDLLGMRDLLENLGYSVVIKENLTAQEMETALRQ 152

  Fly   327 -SACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYY------------KP 378
             :|.......||..:..:||.....:..:     |..|.|..:...||::.            ||
Human   153 FAAHPEHQSSDSTFLVFMSHSILNGICGT-----KHWDQEPDVLHDDTIFEIFNNRNCQSLKDKP 212

  Fly   379 KLLIIQACQEK---LVHKKKPNELFRIDVTTVSPDQH-------------------IDMLRAMST 421
            |::|:|||:..   :|       .|..|....|.|.|                   .|.:...|:
Human   213 KVIIMQACRGNGAGIV-------WFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSS 270

  Fly   422 VNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVK--STF 484
            .....:.||...||.||..:.......|.|.|:.:|...|.:....   .|..:.:|.::  |..
Human   271 TPHNVSWRHETNGSVFISQIIYYFREYSWSHHLEEIFQKVQHSFET---PNILTQLPTIERLSMT 332

  Fly   485 RQHVYFP 491
            |....||
Human   333 RYFYLFP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 56/278 (20%)
CASP12NP_001177945.2 CARD_CASP1-like 6..88 CDD:260036 8/36 (22%)
CASc 103..339 CDD:214521 51/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.