DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dredd and si:ch211-195h23.3

DIOPT Version :9

Sequence 1:NP_477249.3 Gene:Dredd / 31011 FlyBaseID:FBgn0020381 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021334238.1 Gene:si:ch211-195h23.3 / 100170660 ZFINID:ZDB-GENE-070912-174 Length:1001 Species:Danio rerio


Alignment Length:351 Identity:68/351 - (19%)
Similarity:123/351 - (35%) Gaps:117/351 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 FYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKSNGLQAQANLLKDTIISNAPEP--- 221
            |..|||.:..      ||   |.|::....|.:.|  |        ||:.....|..|| :|   
Zfish   264 FPRPAYRKYM------RR---LEDLSDETLDSRFL--H--------QAHTFCSYIYDNA-QPKTV 308

  Fly   222 -------DAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGIAL--IIN-------QQKFH 270
                   .|.|..|....:.|.|.|            .:..|||.::|  |.|       :|.:.
Zfish   309 RGHTITGTALGNLAEIYVEAISSGN------------VICLENAVVSLAKIQNVRAVDQARQIYK 361

  Fly   271 RNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVR 335
            ..:.|.....|.||.|.|..  .:.:|:.|:||.:|.::.:  |.:....::|:|.         
Zfish   362 EEMLRMAQPPLDPDQLSRIH--TLAEEKAIKVFINMSFSDK--DQIYQKELMEKIH--------- 413

  Fly   336 DSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELF 400
                     |.::.....::.                        ..:..|::.|.:...|.||.
Zfish   414 ---------HEYQHMCLQNHQ------------------------AFLMQCRKVLEYSFYPLELK 445

  Fly   401 RIDVTTVSPD---QHIDMLRAMSTVNGYAA-----LRHTQT------GSWFIGS-LCDAIDRRSA 450
            ..|.:.:.|.   |:..:|..:  ::.|.|     ::|.:.      |...:|: :..|.:..||
Zfish   446 ISDGSYLRPGGYRQYRALLNQL--ISDYRARTESQIKHEEALWMFLQGKEDVGNQILQADESLSA 508

  Fly   451 SEHIADILTIVTNEV--SKKRGSNDE 474
            :|...:: .|:.||:  ..:||..::
Zfish   509 AEQEKEV-QILKNEILQQHQRGLEEQ 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DreddNP_477249.3 CASc 252..492 CDD:294037 45/249 (18%)
si:ch211-195h23.3XP_021334238.1 P-loop_NTPase 51..307 CDD:328724 17/62 (27%)
GBP_C 315..602 CDD:293879 51/280 (18%)
coiled coil 573..584 CDD:293879
coiled coil 593..602 CDD:293879
FIIND 645..885 CDD:316110
CARD_ASC_NALP1 910..991 CDD:260039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.