DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and RPL36A

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_013920.1 Gene:RPL36A / 855232 SGDID:S000004807 Length:100 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:46/109 - (42%)
Similarity:67/109 - (61%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            |.|:..:|||||||.|.:.:     |...|:     |..|...:..|||:|.||||:.|.:|||:
Yeast     1 MTVKTGIAIGLNKGKKVTSM-----TPAPKI-----SYKKGAASNRTKFVRSLVREIAGLSPYER 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRK 109
            |.::|::.|.:|||.|..|:|||:..|||.|.||::||:...|:
Yeast    56 RLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 43/104 (41%)
RPL36ANP_013920.1 Ribosomal_L36e 4..99 CDD:395922 43/104 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341317
Domainoid 1 1.000 77 1.000 Domainoid score I2086
eggNOG 1 0.900 - - E1_COG5051
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1613
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53583
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - otm46880
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - O PTHR10114
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X506
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.