DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and RPL36A

DIOPT Version :10

Sequence 1:NP_476629.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_013920.1 Gene:RPL36A / 855232 SGDID:S000004807 Length:100 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:46/109 - (42%)
Similarity:67/109 - (61%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            |.|:..:|||||||.|.:.:     |...|:     |..|...:..|||:|.||||:.|.:|||:
Yeast     1 MTVKTGIAIGLNKGKKVTSM-----TPAPKI-----SYKKGAASNRTKFVRSLVREIAGLSPYER 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRK 109
            |.::|::.|.:|||.|..|:|||:..|||.|.||::||:...|:
Yeast    56 RLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_476629.1 Ribosomal_L36e 4..109 CDD:460088 43/104 (41%)
RPL36ANP_013920.1 Ribosomal_L36e 4..99 CDD:460088 43/104 (41%)

Return to query results.
Submit another query.