DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and AT3G53740

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001030855.1 Gene:AT3G53740 / 824541 AraportID:AT3G53740 Length:112 Species:Arabidopsis thaliana


Alignment Length:106 Identity:52/106 - (49%)
Similarity:69/106 - (65%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRT 67
            |:..|.:||||||..::.........:|.|          .::.|.|:|:|::||.|.||||||.
plant     6 VKTGLFVGLNKGHVVTRRELAPRPRSRKGK----------TSKRTIFIRNLIKEVAGQAPYEKRI 60

  Fly    68 MELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108
            .|||||.|||||||..||:||||.||||||||:|::|.::|
plant    61 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 51/105 (49%)
AT3G53740NP_001030855.1 Ribosomal_L36e 7..101 CDD:395922 50/103 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2403
eggNOG 1 0.900 - - E1_COG5051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133875
Inparanoid 1 1.050 98 1.000 Inparanoid score I2199
OMA 1 1.010 - - QHG53583
OrthoDB 1 1.010 - - D1477459at2759
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - otm3048
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - O PTHR10114
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X506
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.