DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and AT2G37600

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001078017.1 Gene:AT2G37600 / 818337 AraportID:AT2G37600 Length:113 Species:Arabidopsis thaliana


Alignment Length:107 Identity:54/107 - (50%)
Similarity:69/107 - (64%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKR 66
            ||:..|.:||||||..::.........:|.|          .::.|.|:|.|:|||.|.||||||
plant     5 AVKTGLFVGLNKGHVVTRRELAPRPNSRKGK----------TSKRTIFIRKLIREVAGMAPYEKR 59

  Fly    67 TMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108
            ..|||||.|||||||..||:||||.||||||||:|::|.::|
plant    60 ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 52/105 (50%)
AT2G37600NP_001078017.1 Ribosomal_L36e 7..101 CDD:395922 51/103 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2403
eggNOG 1 0.900 - - E1_COG5051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133875
Inparanoid 1 1.050 98 1.000 Inparanoid score I2199
OMA 1 1.010 - - QHG53583
OrthoDB 1 1.010 - - D1477459at2759
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - otm3048
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - O PTHR10114
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.