DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and Rpl36

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_061200.2 Gene:Rpl36 / 54217 MGIID:1860603 Length:105 Species:Mus musculus


Alignment Length:110 Identity:69/110 - (62%)
Similarity:84/110 - (76%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            ||:||.:|:|||||||.:          |.|...|.||.:...|:||||:||::|||.|.||||:
Mouse     1 MALRYPMAVGLNKGHKVT----------KNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYER 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            |.|||||||||||||||:|:|:|||||||||||||||:|..:|||
Mouse    56 RAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 64/104 (62%)
Rpl36NP_061200.2 Ribosomal_L36e 4..94 CDD:395922 63/99 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5525
eggNOG 1 0.900 - - E1_COG5051
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133875
Inparanoid 1 1.050 130 1.000 Inparanoid score I4621
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53583
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - oto94371
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - LDO PTHR10114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2258
SonicParanoid 1 1.000 - - X506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.