DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and rpl36

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001005100.1 Gene:rpl36 / 448678 XenbaseID:XB-GENE-969192 Length:105 Species:Xenopus tropicalis


Alignment Length:110 Identity:67/110 - (60%)
Similarity:83/110 - (75%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            ||:||.:|:||||||:.:          |.|...|..|.:...|:||||:||::|||.|.||||:
 Frog     1 MAIRYPMAVGLNKGHRVT----------KNVTKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYER 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            |.|||||||||||||||:|:|:|||||||||||||||:|..:|||
 Frog    56 RAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVLAAMRKA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 62/104 (60%)
rpl36NP_001005100.1 Ribosomal_L36e 4..94 CDD:366495 61/99 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5274
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133875
Inparanoid 1 1.050 133 1.000 Inparanoid score I4474
OMA 1 1.010 - - QHG53583
OrthoDB 1 1.010 - - D1477459at2759
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - oto104582
Panther 1 1.100 - - LDO PTHR10114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2258
SonicParanoid 1 1.000 - - X506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.