DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and rpl36

DIOPT Version :10

Sequence 1:NP_476629.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_998117.1 Gene:rpl36 / 405888 ZFINID:ZDB-GENE-040622-2 Length:105 Species:Danio rerio


Alignment Length:110 Identity:68/110 - (61%)
Similarity:80/110 - (72%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            |.|||.:|:|||||||.:          |.|...:.||.:...|:|.||.|||:|||.|.||||:
Zfish     1 MVVRYPMAVGLNKGHKVT----------KNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAPYER 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            |.|||||||||||||||:|:|:|||||||||||||||.|..:|||
Zfish    56 RAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNTLAAMRKA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_476629.1 Ribosomal_L36e 4..109 CDD:460088 63/104 (61%)
rpl36NP_998117.1 Ribosomal_L36e 4..94 CDD:460088 62/99 (63%)

Return to query results.
Submit another query.