DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and rpl36

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_998117.1 Gene:rpl36 / 405888 ZFINID:ZDB-GENE-040622-2 Length:105 Species:Danio rerio


Alignment Length:110 Identity:68/110 - (61%)
Similarity:80/110 - (72%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            |.|||.:|:|||||||.:          |.|...:.||.:...|:|.||.|||:|||.|.||||:
Zfish     1 MVVRYPMAVGLNKGHKVT----------KNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAPYER 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            |.|||||||||||||||:|:|:|||||||||||||||.|..:|||
Zfish    56 RAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNTLAAMRKA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 63/104 (61%)
rpl36NP_998117.1 Ribosomal_L36e 4..94 CDD:279499 62/99 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5393
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133875
Inparanoid 1 1.050 130 1.000 Inparanoid score I4619
OMA 1 1.010 - - QHG53583
OrthoDB 1 1.010 - - D1477459at2759
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - oto41612
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - LDO PTHR10114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2258
SonicParanoid 1 1.000 - - X506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.