DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and RGD1564730

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_038940900.1 Gene:RGD1564730 / 301609 RGDID:1564730 Length:102 Species:Rattus norvegicus


Alignment Length:110 Identity:58/110 - (52%)
Similarity:71/110 - (64%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            |.|.|.:|:|||||||.:          |.|:.||.||.....|:|||||:|::|||   ..|::
  Rat     1 MVVCYSVAVGLNKGHKVT----------KNVRKLRRSRCSGRLTKHTKFMQDMIREV---WTYKQ 52

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            .|||||||||||.||||.|..:|.||.|..|||.|||:|..:|||
  Rat    53 CTMELLKVSKDKLALKFTKMSMGAHICAMIKREGLSNVLAAMRKA 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 53/104 (51%)
RGD1564730XP_038940900.1 Ribosomal_L36e 4..96 CDD:395922 53/104 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53583
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - O PTHR10114
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X506
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.