DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and rpl3602

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_596310.1 Gene:rpl3602 / 2540644 PomBaseID:SPBC405.07 Length:99 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:49/104 - (47%)
Similarity:64/104 - (61%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELL 71
            |.:||||| ||...|.:..         |.||.|...::.|.|:|.:||||.|.||||:|.|||:
pombe     5 LVVGLNKG-KTLTKRQLPE---------RPSRRKGHLSKRTAFVRSIVREVAGFAPYERRVMELI 59

  Fly    72 KVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            :.|:||||.|..|:||||..|||.|.|||::::...|.|
pombe    60 RNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSRLA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 47/101 (47%)
rpl3602NP_596310.1 Ribosomal_L36e 4..96 CDD:279499 47/100 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I2360
eggNOG 1 0.900 - - E1_COG5051
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1857
OMA 1 1.010 - - QHG53583
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - otm47334
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - LDO PTHR10114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2258
SonicParanoid 1 1.000 - - X506
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.