DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and rpl3602

DIOPT Version :10

Sequence 1:NP_476629.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_596310.1 Gene:rpl3602 / 2540644 PomBaseID:SPBC405.07 Length:99 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:49/104 - (47%)
Similarity:64/104 - (61%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELL 71
            |.:||||| ||...|.:..         |.||.|...::.|.|:|.:||||.|.||||:|.|||:
pombe     5 LVVGLNKG-KTLTKRQLPE---------RPSRRKGHLSKRTAFVRSIVREVAGFAPYERRVMELI 59

  Fly    72 KVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            :.|:||||.|..|:||||..|||.|.|||::::...|.|
pombe    60 RNSQDKRARKLAKKRLGTLKRAKGKIEELTSVIQSSRLA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_476629.1 Ribosomal_L36e 4..109 CDD:460088 47/101 (47%)
rpl3602NP_596310.1 Ribosomal_L36e 4..96 CDD:460088 47/100 (47%)

Return to query results.
Submit another query.