DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and rpl-36

DIOPT Version :10

Sequence 1:NP_476629.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_498573.2 Gene:rpl-36 / 176007 WormBaseID:WBGene00004450 Length:104 Species:Caenorhabditis elegans


Alignment Length:104 Identity:56/104 - (53%)
Similarity:75/104 - (72%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELL 71
            ||:||||||..:::         .|| .|.:|.|.:.::.||.:|:||||:.|.||||:|.:|:|
 Worm     9 LAVGLNKGHAATQL---------PVK-QRQNRHKGVASKKTKIVRELVREITGFAPYERRVLEML 63

  Fly    72 KVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            ::|||||||||||||:|||.|||.|||||.|::...|||
 Worm    64 RISKDKRALKFLKRRIGTHRRAKGKREELQNVIIAQRKA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_476629.1 Ribosomal_L36e 4..109 CDD:460088 53/101 (52%)
rpl-36NP_498573.2 Ribosomal_L36e 8..101 CDD:460088 53/101 (52%)

Return to query results.
Submit another query.