DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and RpL36

DIOPT Version :10

Sequence 1:NP_476629.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_311984.4 Gene:RpL36 / 1273043 VectorBaseID:AGAMI1_005933 Length:113 Species:Anopheles gambiae


Alignment Length:110 Identity:90/110 - (81%)
Similarity:101/110 - (91%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            ||.|||:.:||||||||:||:.::|.||:||||:|.||||.|||:||||:|||||||||||||||
Mosquito     1 MAPRYEMCVGLNKGHKTTKIKQLQYRGDRKVKGIRPSRLKGIQTKHTKFVRDLVREVVGHAPYEK 65

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            |.|||||||||||||||||||||||||||||||||||||..:|||
Mosquito    66 RGMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILAHMRKA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_476629.1 Ribosomal_L36e 4..109 CDD:460088 85/104 (82%)
RpL36XP_311984.4 Ribosomal_L36e 4..109 CDD:460088 85/104 (82%)

Return to query results.
Submit another query.