DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and LOC100361079

DIOPT Version :9

Sequence 1:NP_001284750.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_008757479.1 Gene:LOC100361079 / 100361079 RGDID:2320881 Length:100 Species:Rattus norvegicus


Alignment Length:109 Identity:68/109 - (62%)
Similarity:83/109 - (76%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            ||:||.:|:||||.||.:|  ||..|        |.||.:...|:||||:||::.||.|.|||.:
  Rat     1 MALRYPMAVGLNKSHKVTK--NVSKT--------RHSRRRGRLTKHTKFVRDMIPEVCGFAPYVR 55

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRK 109
            |||||||||||||||||:|:|:|||||||||||||||:|..:||
  Rat    56 RTMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_001284750.1 Ribosomal_L36e 4..109 CDD:395922 64/104 (62%)
LOC100361079XP_008757479.1 Ribosomal_L36e 4..99 CDD:279499 64/104 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5110
eggNOG 1 0.900 - - E1_COG5051
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4471
OMA 1 1.010 - - QHG53583
OrthoDB 1 1.010 - - D1477459at2759
OrthoFinder 1 1.000 - - FOG0000794
OrthoInspector 1 1.000 - - otm45905
orthoMCL 1 0.900 - - OOG6_101322
Panther 1 1.100 - - O PTHR10114
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X506
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.