DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL36 and Rpl36l3

DIOPT Version :10

Sequence 1:NP_476629.1 Gene:RpL36 / 31009 FlyBaseID:FBgn0002579 Length:115 Species:Drosophila melanogaster
Sequence 2:XP_038957125.1 Gene:Rpl36l3 / 100361060 RGDID:2320900 Length:106 Species:Rattus norvegicus


Alignment Length:110 Identity:69/110 - (62%)
Similarity:84/110 - (76%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEK 65
            ||:||.:|:|||||||.:|  ||.       |.....|.:...|:||||:||::|||.|.||||:
  Rat     1 MALRYPMAVGLNKGHKVTK--NVS-------KPRHSRRRRGRLTKHTKFVRDMIREVCGFAPYER 56

  Fly    66 RTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKA 110
            |.|||||||||||||||:|:|:|||||||||||||||:|..:|||
  Rat    57 RAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL36NP_476629.1 Ribosomal_L36e 4..109 CDD:460088 64/104 (62%)
Rpl36l3XP_038957125.1 Ribosomal_L36e 4..95 CDD:460088 63/99 (64%)

Return to query results.
Submit another query.