DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and ADO1

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_012639.1 Gene:ADO1 / 853569 SGDID:S000003866 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:78/338 - (23%)
Similarity:122/338 - (36%) Gaps:51/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVFGSAIIDF-----ISYTTRL-----------PKAG--------ETLHGHRFQIGYGGKGANQ 46
            ::|.|:.::||     ..|..:.           .|:|        |.|.....::..||...|.
Yeast     5 LVVLGNPLLDFQADVTAEYLAKYSLKENDAILVDAKSGDAKMAIFDELLQMPETKLVAGGAAQNT 69

  Fly    47 CVAAA--RQGSRTALVAKLGADTFGSDYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGENNI 109
            ...||  ....:......:|.|.|....|.  ..|:..|..:.|: :...|..:.|....|.|..
Yeast    70 ARGAAYVLGAGQVVYFGSVGKDKFSERLLN--ENEKAGVKSMYQV-QNDIGTGKCAALITGHNRS 131

  Fly   110 IIV-VGANNRLSSCDVSSAKALFQEAKV-------LVCQLETPVEATLTALRAFRGVSIVNAAP- 165
            ::. :||.|..:...:.....|.:.||:       |....:..|:....|....:...:..:|| 
Yeast   132 LVTDLGAANFFTPDHLDKHWDLVEAAKLFYIGGFHLTVSPDAIVKLGQHAKENSKPFVLNFSAPF 196

  Fly   166 ---AMADTPPELLQLASIFCVNESEAALMTQMPDIGNIEHAEDAVGKLIAAGA---NTVIITLGK 224
               ...|....:|..|::...|||||........:.......:|:.:.|...:   .|||.|.|.
Yeast   197 IPHVFKDALARVLPYATVIIANESEAEAFCDAFQLDCANTDLEAIAQRIVKDSPVEKTVIFTHGV 261

  Fly   225 LGAVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDAFIGALAHNLARHPTRKLEEHIAAACAVAS 289
            ...|..|  |||...:...| :...|:|||.||||||.|.....|.:  ...||..|.....:|:
Yeast   262 EPTVVVS--SKGTSTYPVKP-LDSSKIVDTNGAGDAFAGGFMAGLTK--GEDLETSIDMGQWLAA 321

  Fly   290 QSVQLPGTQSSFP 302
            .|:|..|  .|:|
Yeast   322 LSIQEVG--PSYP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 78/338 (23%)
ADO1NP_012639.1 adenosine_kinase 5..332 CDD:238573 77/336 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.